PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008239921.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 360aa    MW: 40165.2 Da    PI: 7.5338
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008239921.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1791.2e-55171431129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL+kkv   ++++ ++i evd++k+ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ 
  XP_008239921.1  17 LPPGFRFHPTDEELISHYLHKKVIYISFSC-KAIGEVDLNKSEPWDLPGKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYK- 109
                     79****************************.88***************99999*****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +++lvg+kktLvfy+grapkgek++Wvmheyrle
  XP_008239921.1 110 GKSLVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 143
                     999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-658167IPR003441NAC domain
PROSITE profilePS5100559.76517167IPR003441NAC domain
PfamPF023654.0E-2918142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MENVPAGMAE QDEQIDLPPG FRFHPTDEEL ISHYLHKKVI YISFSCKAIG EVDLNKSEPW  60
DLPGKAKMGE KEWYFFCVRD RKYPTGLRTN RATEAGYWKA TGKDKEIYKG KSLVGMKKTL  120
VFYRGRAPKG EKSNWVMHEY RLEGKFSVHN LPKTAKNEWV ICRVFEKNSG GKKTHISGFV  180
RYGAVGNEIG PSGLPPLMDS SPYSSKTKLA SESSYVPCFS NPDPTDVQRN QGIVDYVNNP  240
LFGVSSNSSD FFPRAPFSNS FYSGQSAPVA ANFPFPGSVL MQDQSILRAL LENNGSNMRQ  300
SFKTEGEMVS VSQETGLTSE MNTEISSVMS NLEMGRRPFG DQEAPAAAAG AVDLDNFWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-5671735171NAC domain-containing protein 19
4dul_A3e-5671735171NAC domain-containing protein 19
1ut7_B3e-5671735171NO APICAL MERISTEM PROTEIN
1ut7_A3e-5671735171NO APICAL MERISTEM PROTEIN
1ut4_B3e-5671735171NO APICAL MERISTEM PROTEIN
1ut4_A3e-5671735171NO APICAL MERISTEM PROTEIN
3swp_D3e-5671738174NAC domain-containing protein 19
3swp_C3e-5671738174NAC domain-containing protein 19
3swp_B3e-5671738174NAC domain-containing protein 19
3swp_A3e-5671738174NAC domain-containing protein 19
3swm_D3e-5671738174NAC domain-containing protein 19
3swm_C3e-5671738174NAC domain-containing protein 19
3swm_B3e-5671738174NAC domain-containing protein 19
3swm_A3e-5671738174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008239921.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-160NC100_ARATH; NAC domain-containing protein 100
TrEMBLM5W9R30.0M5W9R3_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s02170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-157NAC domain containing protein 100